LL-37 image de produit d’espace réservé

LL-37

Alternative names
Cathelicidin, hCAP18, Human Antimicrobial Peptide
CAS
154947-66-7
Molecular formula
C205H340N60O53
Molecular weight
4493.33
Amino acid sequence
Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser
Format:
30 

Ce produit est destiné exclusivement à la recherche et aux usages de laboratoire (in vitro). Il n’est pas destiné à un usage diagnostique, thérapeutique, alimentaire, cosmétique, vétérinaire ou comme complément alimentaire.

Les achats sont réservés aux personnes majeures. L’acheteur confirme disposer des connaissances et qualifications nécessaires à la manipulation sûre de produits de recherche.

Description du produit

What is LL-37?

LL-37 is the only antimicrobial peptide from the cathelicidin family found in humans, consisting of 37 amino acids and starting with two leucine residues (hence the name LL-37). The peptide sequence is LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES and its full name is Cathelicidin-related antimicrobial peptide (CAMP).

LL-37 is produced as part of the innate immune system from a larger precursor protein, hCAP18 (human Cationic Antimicrobial Protein 18 kDa). The precursor protein consists of a signal peptide, a cathelin-like domain, and a C-terminal fragment of LL-37. The mature LL-37 peptide is released by proteolytic cleavage by protease 3 in neutrophils or by serine proteases in keratinocytes.

Structurally, LL-37 is an amphophilic peptide - it has both cationic (positively charged) and hydrophobic regions. In aqueous solutions, it adopts an α-helical structure, which is crucial for its biological activity. The molecular weight is approximately 4493 Da. The net positive charge (+6) allows interactions with negatively charged bacterial membranes.

LL-37 is found in many cells, tissues and body fluids, including neutrophils, macrophages, keratinocytes, epithelial cells of the respiratory and gastrointestinal tracts, as well as in sweat, breast milk and seminal fluid. Peptide expression is regulated by vitamin D, linking vitamin D supplementation to antimicrobial immunity.

Mechanism of action

Antimicrobial activity - LL-37 has a broad spectrum of activity against Gram-positive and Gram-negative bacteria, fungi, viruses and parasites. The mechanism involves binding to negatively charged phospholipids of the microbial cell membrane, inserting into the lipid bilayer and forming pores or destabilizing the membrane. Selectivity towards pathogens results from differences in the lipid composition of microbial membranes (more negatively charged lipids) compared to mammalian cells.

Antibiofilm activity - LL-37 has the ability to destroy preformed bacterial biofilms, which distinguishes it from many classic antibiotics. The peptide prevents biofilm formation by inhibiting bacterial adhesion and interfering with intercellular communication (quorum sensing). This activity is particularly important in the context of infected chronic wounds.

PubMed
  • Bhattacharjya S et al. LL-37: Structures, Antimicrobial Activity, and Influence on Amyloid-Related Diseases. Biomolecules. 2024;14(3):320. PMC
  • Ramos R et al. Wound healing activity of the human antimicrobial peptide LL37. Peptides. 2011;32(7):1469-1476. PubMed
  • van Hoek ML. The Human Cathelicidin Antimicrobial Peptide LL-37 as a Potential Treatment for Polymicrobial Infected Wounds. Front Immunol. 2013;4:143. PMC
  • Heilborn JD et al. The cathelicidin anti-microbial peptide LL-37 is involved in re-epithelialization of human skin wounds and is lacking in chronic ulcerative epithelium. J Invest Dermatol. 2003;120(3):379-389. PubMed
  • Bandurska K et al. Unique features of human cathelicidin LL-37. Biofactors. 2015;41(5):289-300. PubMed
  • Nagaoka I et al. Cathelicidin family of antibacterial peptides CAP18 and CAP11 inhibit the expression of TNF-alpha by blocking the binding of LPS to CD14(+) cells. J Immunol. 2001;167(6):3329-3338. PubMed
  • Tokumaru S et al. Induction of keratinocyte migration via transactivation of the epidermal growth factor receptor by the antimicrobial peptide LL-37. J Immunol. 2005;175(7):4662-4668. PubMed
  • Overhage J et al. Human host defense peptide LL-37 prevents bacterial biofilm formation. Infect Immun 2008;76(9):4176-4182. PMC
  • Wang G et al. Design of Antimicrobial Peptides: Progress Made with Human Cathelicidin LL-37. Adv Exp Med Biol. 2019;1117:215-240. PubMed
  • This site is registered on wpml.org as a development site. Switch to a production site key to remove this banner.